PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10002573m
Common NameCARUB_v10002573mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 342aa    MW: 38570.7 Da    PI: 6.372
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10002573mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.66.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l+  ++++G g+W++ ++  g++R++k+c++rw +yl
  Carubv10002573m 14 KGPWTQEEDEKLIVHIQKHGHGSWRALPKQAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding56.46.6e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ +++++ +lG++ W++Ia  ++ gRt++++k++w+++l
  Carubv10002573m  67 RGNFTEEEEQTIINLHSLLGNK-WSSIAGNLP-GRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.1E-27564IPR009057Homeodomain-like
PROSITE profilePS5129417.445961IPR017930Myb domain
SuperFamilySSF466895.29E-3211108IPR009057Homeodomain-like
SMARTSM007174.5E-151363IPR001005SANT/Myb domain
PfamPF002491.2E-161461IPR001005SANT/Myb domain
CDDcd001675.93E-121661No hitNo description
PROSITE profilePS5129427.77462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2765116IPR009057Homeodomain-like
SMARTSM007171.3E-1666114IPR001005SANT/Myb domain
PfamPF002492.0E-1667112IPR001005SANT/Myb domain
CDDcd001671.90E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTQE EDEKLIVHIQ KHGHGSWRAL PKQAGLNRCG KSCRLRWTNY  60
LRPDIKRGNF TEEEEQTIIN LHSLLGNKWS SIAGNLPGRT DNEIKNYWNT HLRKKLLQMG  120
IDPVTHRPRT DHLNVLAALP QLMAAAANFN SLLNLNQNVQ LDATSLAKAQ LIHNMIQVLS  180
NNNNTNNPSF SSSTMQNNNN LFGQSSYSEN QTIFGQSQSF SNILDENNHD HDDLMVKSQI  240
VDHPLDSLTS GPIQPDFHDD HNSLPLLVPA SPEDSKQPMI KKNDIGNYHH HPDHTTNPSS  300
SNSTFTQDHH QPWCDIIDDG ASDSYWKEII EQTCSEPWPF P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-311211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006286654.10.0hypothetical protein CARUB_v10002573mg
TrEMBLR0FBX10.0R0FBX1_9BRAS; Uncharacterized protein
STRINGAT5G16770.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.21e-173myb domain protein 9